PDB entry 1kc6

View 1kc6 on RCSB PDB site
Description: HincII Bound to Cognate DNA
Class: hydrolase/DNA
Keywords: restriction endonuclease, blunt cutting, protein-dna, indirect readout, dna bending, HYDROLASE/DNA COMPLEX
Deposited on 2001-11-07, released 2001-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-256)
      • see remark 999 (128)
      • see remark 999 (171)
    Domains in SCOPe 2.07: d1kc6a_
  • Chain 'B':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-End)
      • see remark 999 (128)
      • see remark 999 (171)
    Domains in SCOPe 2.07: d1kc6b_
  • Chain 'C':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-End)
      • see remark 999 (128)
      • see remark 999 (171)
    Domains in SCOPe 2.07: d1kc6c_
  • Chain 'D':
    Compound: Type II restriction enzyme HincII
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17743 (0-End)
      • see remark 999 (128)
      • see remark 999 (171)
    Domains in SCOPe 2.07: d1kc6d_
  • Chain 'E':
    Compound: 5'-d(p*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'F':
    Compound: 5'-d(p*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'G':
    Compound: 5'-d(p*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Chain 'H':
    Compound: 5'-d(p*cp*cp*gp*gp*tp*cp*gp*ap*cp*cp*gp*g)-3'
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kc6A (A:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc6A (A:)
    sfikpiyqdinsiligqkvkrpaagepfeklvykflkenlsdltfkqyeylndlfmknpa
    iighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvk
    trnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfae
    lfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkf
    vkpfkkyil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kc6B (B:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc6B (B:)
    sfikpiyqdinsiligqkvkraagepfeklvykflkenlsdltfkqyeylndlfmknpai
    ighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvkt
    rnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfael
    fksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfv
    kpfkkyi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kc6C (C:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc6C (C:)
    sfikpiyqdinsiligqkvkagepfeklvykflkenlsdltfkqyeylndlfhearyklf
    nsptllfllsrgkaatenwsifeekqndtadillvkqfyelldvktrnisksaqapniis
    ayklaqtcakmidnkefdlfdinylevdwelngedlvcvstsfaelfksepselyinwaa
    amqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkkyi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kc6D (D:)
    sfikpiyqdinsiligqkvkrpksgtlsghaagepfeklvykflkenlsdltfkqyeyln
    dlfmknpaiighearyklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdq
    fyelldvktrnisksaqapniisayklaqtcakmidnkefdlfdinylevdwelngedlv
    cvstsfaelfksepselyinwaaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqr
    aismidkfvkpfkkyil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc6D (D:)
    sfikpiyqdinsiligqkgepfeklvykflkenlsdltfkqyeylndlfmknpaiighea
    ryklfnsptllfllsrgkaatenwsienlfeekqndtadillvkdqfyelldvktrnisk
    saqapniisayklaqtcakmidnkefdlfdinylevdwlvcvstsfaelfksepselyin
    waaamqiqfhvrdldqgfngtreewaksylkhfvtqaeqraismidkfvkpfkkyi
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.