PDB entry 1kc5

View 1kc5 on RCSB PDB site
Description: crystal structure of antibody pc287 in complex with ps1 peptide
Class: immune system
Keywords: antibody, peptide antigen, complex (antibody/peptide), immune system
Deposited on 2001-11-07, released 2002-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: pc287 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kc5h1, d1kc5h2
  • Chain 'L':
    Compound: pc287 immunoglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kc5l1, d1kc5l2
  • Chain 'P':
    Compound: PS1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAK97192 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kc5H (H:)
    qvklqqsgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmayisysgstty
    npslksrisitrdtsknqfflqlnsvttedtaiyycarggtgfdywgagttltvsaaatt
    ppsvyplapgsataaasmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdlytl
    sssvtvpsspwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kc5L (L:)
    divltqspksmsmsvgekvtlsckasenvdtyvswyqqrpeqppalliygasnrytgvpd
    rftgsgsatdftltissvqaedladyhcgqsysypltfgggtklelkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvanswtaqdskdstysmsstlt
    ltkdeyerhnsytceathktstspvvksfnrnec
    

  • Chain 'P':
    No sequence available.