PDB entry 1kc3

View 1kc3 on RCSB PDB site
Description: Crystal structure of dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) in complex with NADPH and dTDP-L-rhamnose
Deposited on 2001-11-07, released 2002-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kc3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kc3A (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt