PDB entry 1kc2

View 1kc2 on RCSB PDB site
Description: structure of the triple (lys(beta)d3ala, asp(beta)c8ala, aspcd2ala) mutant of the src sh2 domain bound to the pqpyeeipi peptide
Deposited on 2001-11-07, released 2002-04-17
The last revision prior to the SCOP 1.67 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1kc2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kc2A (A:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvsafanakglnvahyki
    rkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kc2A (A:)
    aeewyfgkitrreserlllnpenprgtflvresettkgayclsvslnvahykirkldsgg
    fyitsrtqfsslqqlvayyskhadglchrltnvcpt