PDB entry 1kbz

View 1kbz on RCSB PDB site
Description: Crystal Structure of apo-dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) from Salmonella enterica serovar Typhimurium
Deposited on 2001-11-07, released 2002-06-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-28, with a file datestamp of 2002-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kbza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbzA (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt