PDB entry 1kbz

View 1kbz on RCSB PDB site
Description: Crystal Structure of apo-dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) from Salmonella enterica serovar Typhimurium
Class: oxidoreductase
Keywords: Rossman-fold, sugar-nucleotide-binding domain, OXIDOREDUCTASE
Deposited on 2001-11-07, released 2002-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dTDP-glucose oxidoreductase
    Species: Salmonella typhimurium [TaxId:602]
    Gene: rfbA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kbza_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kbzA (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbzA (A:)
    mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
    aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
    atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
    dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
    laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt