PDB entry 1kbr

View 1kbr on RCSB PDB site
Description: crystal structure of unligated hppk(r92a) from e.coli at 1.55 angstrom resolution
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, pterin, 6-hydroxymethyl-7,8-dihydropterin, antimicrobial agent, drug design, x-ray crystallography, transferase
Deposited on 2001-11-06, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26281 (0-157)
    • engineered (91)
  Domains in SCOPe 2.08: d1kbra_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbrA (A:)
  tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
  etslapeellnhtqrielqqgrvrkaerwgpatldldimlfgnevinterltvphydmkn
  rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw