PDB entry 1kbq

View 1kbq on RCSB PDB site
Description: Complex of Human NAD(P)H quinone Oxidoreductase with 5-methoxy-1,2-dimethyl-3-(4-nitrophenoxymethyl)indole-4,7-dione (ES936)
Deposited on 2001-11-06, released 2002-01-16
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-16, with a file datestamp of 2002-01-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.215
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kbqa_
  • Chain 'B':
    Domains in SCOP 1.59: d1kbqb_
  • Chain 'C':
    Domains in SCOP 1.59: d1kbqc_
  • Chain 'D':
    Domains in SCOP 1.59: d1kbqd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbqA (A:)
    grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbqB (B:)
    rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
    anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
    efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
    vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
    qdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbqC (C:)
    rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
    anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
    efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
    vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
    qdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbqD (D:)
    grralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark