PDB entry 1kbj

View 1kbj on RCSB PDB site
Description: Crystallographic Study of the Recombinant Flavin-binding Domain of Baker's Yeast Flavocytochrome b2: comparison with the Intact Wild-type Enzyme
Deposited on 2001-11-06, released 2002-04-03
The last revision prior to the SCOP 1.69 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.157
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kbja_
  • Chain 'B':
    Domains in SCOP 1.69: d1kbjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kbjA (A:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
    vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelk
    kktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrn
    lkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeie
    msmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbjA (A:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
    vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsasralskfidpsltwkdieelkkktklpivikgvqrtedvi
    kaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdv
    lkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdll
    dlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kbjB (B:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
    vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsntkagpkamkktnveesqgasralskfidpsltwkdieelk
    kktklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrn
    lkdklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeie
    msmrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kbjB (B:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqg
    vtkvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfasralskfidpsltwkdieelkkktklpivikgvqrtedvik
    aaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvl
    kalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlld
    lstlkartvgvpndvlynevyegptltefeda