PDB entry 1kbg

View 1kbg on RCSB PDB site
Description: MHC class I h-2kb presented glycopeptide rgy8-6h-gal2
Class: immune system
Keywords: MHC, major histocompatibility complex, antigen presentation, glycopeptide, cellular immunity, immunology, cell surface receptor, synthetic peptide, vaccine
Deposited on 1998-08-28, released 1999-02-09
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (major histocompatibility complex class I antigen h-2kb)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kbgh1, d1kbgh2
  • Chain 'L':
    Compound: protein (beta-2-microglobulin)
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kbgl_
  • Chain 'P':
    Compound: protein (synthetic glycopeptide rgy8-6h-gal2)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11212 (0-7)
      • engineered (5)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbgH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrw
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbgL (L:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.