PDB entry 1kbf

View 1kbf on RCSB PDB site
Description: Solution Structure of the Cysteine-Rich C1 Domain of Kinase Suppressor of Ras
Class: signaling protein
Keywords: Cysteine-rich domain, Zinc-binding protein, SIGNALING PROTEIN
Deposited on 2001-11-06, released 2002-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Kinase suppressor of Ras 1
  Species: Mus musculus [TaxId:10090]
  Gene: Ksr1, Ksr
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q61097 (1-48)
    • expression tag (0)
  Domains in SCOPe 2.08: d1kbfa1, d1kbfa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kbfA (A:)
  gsvthrfstkswlsqvcnvcqksmifgvkckhcrlkchnkctkeapacr