PDB entry 1kbc

View 1kbc on RCSB PDB site
Description: procarboxypeptidase ternary complex
Deposited on 1997-04-29, released 1997-08-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-08-12, with a file datestamp of 1997-08-13.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kbca_
  • Chain 'B':
    Domains in SCOP 1.59: d1kbcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbcA (A:)
    fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
    niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
    fghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kbcB (B:)
    fmltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadi
    niafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahe
    fghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg