PDB entry 1kb5

View 1kb5 on RCSB PDB site
Description: murine T-cell receptor variable domain/fab complex
Class: complex (immunoglobulin/receptor)
Keywords: T-cell receptor, strand switch, fab, anticlonotypic, (immunoglobulin/receptor)
Deposited on 1997-04-06, released 1998-04-08
The last revision prior to the SCOP 1.75 freeze date was dated 1998-04-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kb5-c20 T-cell antigen receptor
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB AAA63396 (0-110)
    Domains in SCOP 1.75: d1kb5a_
  • Chain 'B':
    Compound: kb5-c20 T-cell antigen receptor
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04214 (0-115)
      • insertion (98)
      • conflict (99-100)
      • insertion (102-103)
      • conflict (103)
      • conflict (108-109)
    Domains in SCOP 1.75: d1kb5b_
  • Chain 'H':
    Compound: antibody desire-1
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kb5h1, d1kb5h2
  • Chain 'L':
    Compound: antibody desire-1
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (2-213)
      • conflict (26)
      • conflict (54)
      • conflict (95)
      • conflict (99)
      • conflict (105)
    Domains in SCOP 1.75: d1kb5l1, d1kb5l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5A (A:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvspgsad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5H (H:)
    evqlqqsgpelekpgasvkisckasgysftgynmnwvkqsngkslewignidpyyggisy
    nqkfkgratltvdkssstaymqlksltsedsavyycarsrtdlyyfdywgqgttltvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5L (L:)
    diqmtqspaslsasvgetvtitcraskniysylawyqqkqgkspqllvynaktlgegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec