PDB entry 1kb5

View 1kb5 on RCSB PDB site
Description: murine t-cell receptor variable domain/fab complex
Deposited on 1997-04-06, released 1998-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 1998-04-08, with a file datestamp of 1998-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5A (A:)
    qqvrqspqsltvwegetailncsyedstfnyfpwyqqfpgegpallisirsvsdkkedgr
    ftiffnkrekklslhitdsqpgdsatyfcaaryqggralifgtgttvsvspgsad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5B (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsaapdwgasaetlyfgsgtrltvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5H (H:)
    evqlqqsgpelekpgasvkisckasgysftgynmnwvkqsngkslewignidpyyggisy
    nqkfkgratltvdkssstaymqlksltsedsavyycarsrtdlyyfdywgqgttltvssa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kb5L (L:)
    diqmtqspaslsasvgetvtitcraskniysylawyqqkqgkspqllvynaktlgegvps
    rfsgsgsgtqfslkinslqpedfgsyycqhhygtpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec