PDB entry 1kaw

View 1kaw on RCSB PDB site
Description: structure of single stranded DNA binding protein (ssb)
Class: DNA-binding protein
Keywords: DNA-binding protein, single stranded DNA binding protein, ssb
Deposited on 1996-12-06, released 1997-12-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.221
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kawa_
  • Chain 'B':
    Compound: single-stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kawb_
  • Chain 'C':
    Compound: single-stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kawc_
  • Chain 'D':
    Compound: single-stranded DNA binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kawd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kawA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kawA (A:)
    rgvnkvilvgnlgqdpevrymavanitlatseseqtewhrvvlfgklaevaseylrkgsq
    vyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kawB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kawB (B:)
    rgvnkvilvgnlgqdpevrymavanitlatseseqtewhrvvlfgklaevaseylrkgsq
    vyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kawC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kawC (C:)
    rgvnkvilvgnlgqdpevrymavanitlatseseqtewhrvvlfgklaevaseylrkgsq
    vyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kawD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggrqggga
    paggnigggqpqggw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kawD (D:)
    rgvnkvilvgnlgqdpevrymavanitlatseseqtewhrvvlfgklaevaseylrkgsq
    vyiegqlrtrkwtdqsgqdryttevvvnvggtmqml