PDB entry 1kau

View 1kau on RCSB PDB site
Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution
Class: hydrolase (urea amido)
Keywords: nickel metalloenzyme
Deposited on 1995-02-16, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 1995-07-10, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: klebsiella aerogenes urease
    Species: Klebsiella aerogenes
    Domains in SCOPe 2.07: d1kaua_
  • Chain 'B':
    Compound: klebsiella aerogenes urease
    Species: Klebsiella aerogenes
    Domains in SCOPe 2.07: d1kaub_
  • Chain 'C':
    Compound: klebsiella aerogenes urease
    Species: Klebsiella aerogenes
    Domains in SCOPe 2.07: d1kauc1, d1kauc2
  • Heterogens: NI, CBX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kauA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kauB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgplevnde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kauB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kauC (C:)
    msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
    laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
    aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
    lqaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademd
    iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
    tlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
    sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
    vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
    gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
    yevrvdgelitsepadvlpmaqryflf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kauC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf