PDB entry 1kas

View 1kas on RCSB PDB site
Description: beta-ketoacyl-acp synthase ii from escherichia coli
Deposited on 1997-12-22, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.242
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kas_ (-)
    krrvvvtglgmlspvgntvestwkallagqsgislidhfdtsayatkfaglvkdfncedi
    isrkeqrkmdafiqygivagvqamqdsgleiteenatrigaaigsgigglglieenhtsl
    mnggprkispffvpstivnmvaghltimyglrgpsisiatactsgvhnighaariiaygd
    advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkerdgfvlgdgagmlvle
    eyehakkrgakiyaelvgfgmssdayhmtsppengagaalamanalrdagieasqigyvn
    ahgtstpagdkaeaqavktifgeaasrvlvsstksmtghllgaagavesiysilalrdqa
    vpptinldnpdegcdldfvphearqvsgmeytlcnsfgfggtngslifkki