PDB entry 1kam

View 1kam on RCSB PDB site
Description: Structure of Bacillus subtilis Nicotinic Acid Mononucleotide Adenylyl Transferase
Class: transferase
Keywords: Rossmann fold, TRANSFERASE
Deposited on 2001-11-02, released 2002-07-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54455 (5-193)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1kama1, d1kama2
  • Chain 'B':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54455 (5-End)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1kamb1, d1kamb2
  • Chain 'C':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54455 (5-End)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1kamc1, d1kamc2
  • Chain 'D':
    Compound: nicotinate-nucleotide adenylyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: nadD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54455 (5-End)
      • cloning artifact (5)
    Domains in SCOPe 2.06: d1kamd1, d1kamd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kamA (A:)
    hmpggskkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfh
    rvemlklaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpk
    wykldellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipd
    kvkkyveenglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kamA (A:)
    skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnps
    fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfi
    gvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglyes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kamB (B:)
    hmpggskkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfh
    rvemlklaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpk
    wykldellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipd
    kvkkyveenglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kamB (B:)
    skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphtdsfhrvemlklaiqs
    npsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykiqfigvkr
    pgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kamC (C:)
    hmpggskkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfh
    rvemlklaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpk
    wykldellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipd
    kvkkyveenglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kamC (C:)
    skkigifggtfdpphnghllmanevlyqagldeiwfmpnqipdsfhrvemlklaiqsnps
    fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwykldellnliqfi
    gvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kamD (D:)
    hmpggskkigifggtfdpphnghllmanevlyqagldeiwfmpnqipphkqnedytdsfh
    rvemlklaiqsnpsfklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpk
    wykldellnliqfigvkrpgfhvetpypllfadvpefevsstmirerfkskkptdylipd
    kvkkyveenglyes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kamD (D:)
    skkigifggtfdpphnghllmanevlyqagldeiwfmpnqitdsfhrvemlklaiqsnps
    fklelvemeregpsytfdtvsllkqrypndqlffiigadmieylpkwyklliqfigvkrp
    gfhvetpypllfadvpefevsstmirerfkskkptdylipdkvkkyveenglye