PDB entry 1kac

View 1kac on RCSB PDB site
Description: knob domain from adenovirus serotype 12 in complex with domain 1 of its cellular receptor car
Class: Viral protein/receptor
Keywords: adhesion protein receptor complex, viral protein/receptor complex
Deposited on 1999-05-05, released 1999-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.22
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fiber knob protein)
    Species: Human adenovirus 12 [TaxId:28282]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kaca_
  • Chain 'B':
    Compound: protein (coxsackie virus and adenovirus receptor)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78310 (0-123)
      • conflict (0)
    Domains in SCOPe 2.08: d1kacb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kacA (A:)
tpydpltlwttpdpppncsliqeldakltlcltkngsivngivslvgvkgnllniqsttt
tvgvhlvfdeqgrlitstptalvpqaswgyrqgqsvstntvtnglgfmpnvsayprpnas
eaksqmvsltylqgdtskpitmkvafngitslngysltfmwsglsnyinqpfstpscsfs
yitqe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kacB (B:)
gittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga