PDB entry 1kaa

View 1kaa on RCSB PDB site
Description: stress and strain in staphylococcal nuclease
Deposited on 1992-12-18, released 1994-01-31
The last revision prior to the SCOP 1.69 freeze date was dated 1995-03-08, with a file datestamp of 1995-03-23.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1kaa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kaa_ (-)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvyapnntheqhl
    rkseaqakkeklniws