PDB entry 1ka4

View 1ka4 on RCSB PDB site
Description: Structure of Pyrococcus furiosus carboxypeptidase Nat-Pb
Class: carboxypeptidase
Keywords: HEXXH motif, M32 family, metallopeptidase, carboxypeptidase
Deposited on 2001-10-31, released 2002-11-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M32 carboxypeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ka4a_
  • Heterogens: PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ka4A (A:)
    meevfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshel
    llhpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkawe
    eakakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevle
    kklkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpf
    ttefgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihes
    qsrfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtyn
    fhillrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyf
    ptytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkka
    igedmdaeyfvrwvkekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ka4A (A:)
    evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
    hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
    kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
    lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
    efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
    rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
    illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
    ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
    edmdaeyfvrwvkekyl