PDB entry 1ka3

View 1ka3 on RCSB PDB site
Description: Anti-sigma Factor AsiA
Class: transcription
Keywords: helix-loop-helix
Deposited on 2001-10-31, released 2001-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-06-22, with a file datestamp of 2007-04-25.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10 KDA Anti-Sigma Factor
    Species: T4 bacteriophage
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ka3a_
  • Chain 'B':
    Compound: 10 KDA Anti-Sigma Factor
    Species: T4 bacteriophage
    Gene: asiA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ka3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ka3A (A:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ka3A (A:)
    nknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivsel
    tqedkktlidefnegfegvyrylemytnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ka3B (B:)
    mnknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivse
    ltqedkktlidefnegfegvyrylemytnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ka3B (B:)
    nknidtvreiitvasilikfsredivenranfiaflneigvthegrklnqnsfrkivsel
    tqedkktlidefnegfegvyrylemytnk