PDB entry 1k9x

View 1k9x on RCSB PDB site
Description: Structure of Pyrococcus furiosus carboxypeptidase Apo-Yb
Class: carboxypeptidase
Keywords: HEXXH motif, M32 family, metallopeptidase, carboxypeptidase
Deposited on 2001-10-31, released 2002-11-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M32 carboxypeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9xa_
  • Chain 'B':
    Compound: M32 carboxypeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9xb_
  • Chain 'C':
    Compound: M32 carboxypeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9xc_
  • Chain 'D':
    Compound: M32 carboxypeptidase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9xd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9xA (A:)
    meevfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshel
    llhpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkawe
    eakakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevle
    kklkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpf
    ttefgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihes
    qsrfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtyn
    fhillrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyf
    ptytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkka
    igedmdaeyfvrwvkekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9xA (A:)
    evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
    hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
    kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
    lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
    efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
    rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
    illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
    ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
    edmdaeyfvrwvkekyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k9xB (B:)
    meevfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshel
    llhpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkawe
    eakakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevle
    kklkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpf
    ttefgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihes
    qsrfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtyn
    fhillrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyf
    ptytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkka
    igedmdaeyfvrwvkekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9xB (B:)
    evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
    hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
    kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
    lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
    efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
    rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
    illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
    ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
    edmdaeyfvrwvkekyl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k9xC (C:)
    meevfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshel
    llhpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkawe
    eakakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevle
    kklkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpf
    ttefgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihes
    qsrfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtyn
    fhillrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyf
    ptytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkka
    igedmdaeyfvrwvkekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9xC (C:)
    evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
    hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
    kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
    lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
    efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
    rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
    illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
    ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
    edmdaeyfvrwvkekyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1k9xD (D:)
    meevfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshel
    llhpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkawe
    eakakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevle
    kklkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpf
    ttefgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihes
    qsrfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtyn
    fhillrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyf
    ptytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkka
    igedmdaeyfvrwvkekyl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9xD (D:)
    evfqnetikqilakyrriwaighaqsvlgwdlevnmpkegilersvaqgelsvlshelll
    hpefvnlvekakglenlneyergivrvldrsiriarafppefirevsettslatkaweea
    kakddfskfepwldkiislakraaeylgyeeepydalldlyeeglrtrdvekmfevlekk
    lkplldkileegkvprehplekekyerewmervnlwilqkfgfplgtrarldvsahpftt
    efgirdvrittryegydfrrtilstvhefghalyelqqderfmftpiaggvslgihesqs
    rfweniigrskefveliypvlkenlpfmsnytpedvylyfnivrpdfirteadvvtynfh
    illrfklerlmvseeikakdlpemwndemerllgirprkysegilqdihwahgsigyfpt
    ytigtllsaqlyyhikkdipdfeekvakaefdpikawlrekihrwgsiyppkellkkaig
    edmdaeyfvrwvkekyl