PDB entry 1k9u

View 1k9u on RCSB PDB site
Description: Crystal Structure of the Calcium-Binding Pollen Allergen Phl p 7 (Polcalcin) at 1.75 Angstroem
Deposited on 2001-10-30, released 2003-04-30
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-30, with a file datestamp of 2003-04-30.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1k9ua_
  • Chain 'B':
    Domains in SCOP 1.65: d1k9ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9uA (A:)
    maddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnef
    isfcnanpglmkdvakvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9uA (A:)
    ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
    fcnanpglmkdvakvf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k9uB (B:)
    maddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnef
    isfcnanpglmkdvakvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9uB (B:)
    ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
    fcnanpglmkdvakvf