PDB entry 1k9t

View 1k9t on RCSB PDB site
Description: chitinase a complexed with tetra-n-acetylchitotriose
Deposited on 2001-10-30, released 2002-11-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9tA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsyafygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9tA (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwefpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsyafygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsag