PDB entry 1k9q

View 1k9q on RCSB PDB site
Description: YAP65 WW domain complexed to N-(n-octyl)-GPPPY-NH2
Class: structural protein
Keywords: WW domain, YAP65, beta-sheet proteins, ligands, proline-rich peptides, STRUCTURAL PROTEIN
Deposited on 2001-10-30, released 2001-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 65 kda yes-associated protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1k9qa_
  • Chain 'B':
    Compound: WW Domain Binding Protein-1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAD10950 (0-4)
      • engineered (0)
  • Heterogens: OCT

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9qA (A:)
    feipddvplpagwemaktssgqryflnhidqtttwqdprk
    

  • Chain 'B':
    No sequence available.