PDB entry 1k9p

View 1k9p on RCSB PDB site
Description: crystal structure of calcium free (or apo) human s100a6
Class: signaling protein
Keywords: s100a6, calcyclin, calcium regulatory protein, calcium free, apo, cacy
Deposited on 2001-10-29, released 2002-04-10
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100a6
    Species: HOMO SAPIENS
    Gene: S100A6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1k9pa_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9pA (A:)
    macpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedl
    drnkdqevnfqeyvtflgalaliynealkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9pA (A:)
    acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
    rnkdqevnfqeyvtflgalaliynealkg