PDB entry 1k9p

View 1k9p on RCSB PDB site
Description: crystal structure of calcium free (or apo) human s100a6
Deposited on 2001-10-29, released 2002-04-10
The last revision prior to the SCOP 1.63 freeze date was dated 2002-04-10, with a file datestamp of 2002-04-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1k9pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9pA (A:)
    acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
    rnkdqevnfqeyvtflgalaliynealkg