PDB entry 1k9o

View 1k9o on RCSB PDB site
Description: crystal structure of michaelis serpin-trypsin complex
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Michaelis serpin-protease complex inhibitory triad, Hydrolase/Hydrolase Inhibitor COMPLEX
Deposited on 2001-10-29, released 2001-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.158
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: trypsin II anionic
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00763 (0-222)
      • engineered (176)
    Domains in SCOPe 2.07: d1k9oe_
  • Chain 'I':
    Compound: alaserpin
    Species: Manduca sexta [TaxId:7130]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14754 (Start-377)
      • see remark 999 (271)
      • see remark 999 (314)
      • engineered (344)
    Domains in SCOPe 2.07: d1k9oi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9oE (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkdscqgdaggp
    vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1k9oI (I:)
    magetdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshde
    llralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgs
    evqnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkf
    vkertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnq
    vdgitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpg
    aarlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfy
    felkidgipmfngkviep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9oI (I:)
    getdlqkilresndqftaqmfsevvkanpgqnvvlsafsvlpplgqlalasvgeshdell
    ralalpndnvtkdvfadlnrgvravkgvdlkmaskiyvakglelnddfaavsrdvfgsev
    qnvdfvksveaagainkwvedqtnnriknlvdpdaldettrsvlvnaiyfkgswkdkfvk
    ertmdrdfhvskdktikvptmigkkdvryadvpeldakmiemsyegdqasmiiilpnqvd
    gitaleqklkdpkalsraeerlynteveitlpkfkietttdlkevlsnmnikklftpgaa
    rlenllktkesltvdaaiqkafievneegaeaaaanafgivpkslilypevhidrpfyfe
    lkidgipmfngkviep