PDB entry 1k9j

View 1k9j on RCSB PDB site
Description: Complex of DC-SIGNR and GlcNAc2Man3
Class: sugar binding protein
Keywords: C-type lectin, protein carbohydrate complex, SUGAR BINDING PROTEIN
Deposited on 2001-10-29, released 2001-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mDC-SIGN2 TYPE I ISOFORM
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAK91859
    Domains in SCOPe 2.06: d1k9ja_
  • Chain 'B':
    Compound: mDC-SIGN2 TYPE I ISOFORM
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAK91859
    Domains in SCOPe 2.06: d1k9jb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9jA (A:)
    aerlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqts
    rsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnr
    cdvdnywickkpaacfrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9jA (A:)
    crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr
    fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd
    nywickkpaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k9jB (B:)
    aerlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqts
    rsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnr
    cdvdnywickkpaacfrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9jB (B:)
    hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs
    wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny
    wickkpaa