PDB entry 1k9j

View 1k9j on RCSB PDB site
Description: complex of dc-signr and glcnac2man3
Deposited on 2001-10-29, released 2001-12-21
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-21, with a file datestamp of 2001-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k9ja_
  • Chain 'B':
    Domains in SCOP 1.59: d1k9jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9jA (A:)
    crhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnr
    fswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvd
    nywickkpaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9jB (B:)
    hcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfs
    wmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdny
    wickkpaa