PDB entry 1k9f

View 1k9f on RCSB PDB site
Description: crystal structure of a mutated family-67 alpha-d-glucuronidase (e285n) from bacillus stearothermophilus t-6, complexed with aldotetraouronic acid
Deposited on 2001-10-29, released 2002-10-29
The last revision prior to the SCOP 1.65 freeze date was dated 2002-10-29, with a file datestamp of 2002-10-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9fA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrrwwketakriyqyipdfggfvvkadsnfrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9fA (A:)
    gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet
    ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
    llqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdy
    arllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspie
    igglptadpldpevrrwwketakriyqyipdfggfvvkapgpftygrdhaeganmlaeal
    apfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvr
    epvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvi
    dgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtf
    gddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadr
    dgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhi
    ynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksg
    iddqygrkiyr