PDB entry 1k9e

View 1k9e on RCSB PDB site
Description: Crystal structure of a mutated family-67 alpha-D-glucuronidase (E285N) from Bacillus stearothermophilus T-6, complexed with 4-O-methyl-glucuronic acid
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-10-29, released 2002-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-d-glucuronidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: aguA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k9ea1, d1k9ea2
  • Heterogens: GCV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9eA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrrwwketakriyqyipdfggfvvkadsnfrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9eA (A:)
    gyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevnet
    ansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflr
    llqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdy
    arllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspie
    igglptadpldpevrrwwketakriyqyipdfggfvvkapgpftygrdhaeganmlaeal
    apfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvr
    epvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvi
    dgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtf
    gddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadr
    dgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhi
    ynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksg
    iddqygrkiyr