PDB entry 1k9d

View 1k9d on RCSB PDB site
Description: The 1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-10-29, released 2002-10-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-d-glucuronidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: aguA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k9da1, d1k9da2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k9dA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrwwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k9dA (A:)
    yepcwlryerkdqysrlrfeeivakrtspifqaaveelqkglrsmmeiepqvvqevneta
    nsiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhflrl
    lqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikdya
    rllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspiei
    gglptadpldpevrwwwketakriyqyipdfggfvvkapgpftygrdhaeganmlaeala
    pfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvre
    pvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvid
    gslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfg
    ddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrd
    gigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiy
    nthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgi
    ddqygrkiyr