PDB entry 1k99

View 1k99 on RCSB PDB site
Description: Solution Structure of the first HMG box in human Upstream binding factor
Class: DNA binding protein
Keywords: alpha-helix, L-shape, DNA BINDING PROTEIN
Deposited on 2001-10-28, released 2001-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Upstream binding factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: hUBF(103-192)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17480 (1-90)
      • initiating met (0)
    Domains in SCOPe 2.07: d1k99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1k99A (A:)
mkklkkhpdfpkkpltpyfrffmekrakyaklhpemsnldltkilskkykelpekkkmky
iqdfqrekqefernlarfredhpdliqnakklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >1k99A (A:)
mkklkkhpdfpkkpltpyfrffmekrakyaklhpemsnldltkilskkykelpekkkmky
iqdfqrekqefernlarfredhpdliqnakk