PDB entry 1k99

View 1k99 on RCSB PDB site
Description: solution structure of the first hmg box in human upstream binding factor
Deposited on 2001-10-28, released 2001-11-14
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1k99a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1k99A (A:)
  mkklkkhpdfpkkpltpyfrffmekrakyaklhpemsnldltkilskkykelpekkkmky
  iqdfqrekqefernlarfredhpdliqnakk