PDB entry 1k96

View 1k96 on RCSB PDB site
Description: crystal structure of calcium bound human s100a6
Class: signaling protein
Keywords: s100a6, calcyclin, calcium regulatory protein, calcium bound, cacy, signaling protein
Deposited on 2001-10-26, released 2002-04-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.214
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100a6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1k96a_
  • Heterogens: CA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k96A (A:)
    macpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedl
    drnkdqevnfqeyvtflgalaliynealkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k96A (A:)
    acpldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
    rnkdqevnfqeyvtflgalaliynealkg