PDB entry 1k95

View 1k95 on RCSB PDB site
Description: crystal structure of des(1-52)grancalcin with bound calcium
Deposited on 2001-10-26, released 2001-12-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.211
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k95a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k95A (A:)
    svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
    afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
    iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k95A (A:)
    svytyfsavaevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfnafke
    lwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngriffd
    dyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai