PDB entry 1k94

View 1k94 on RCSB PDB site
Description: Crystal structure of des(1-52)grancalcin with bound calcium
Deposited on 2001-10-26, released 2001-12-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.203
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1k94a_
  • Chain 'B':
    Domains in SCOP 1.59: d1k94b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k94A (A:)
    svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
    afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
    iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k94B (B:)
    svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
    afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
    iffddyvaccvklraltdffrkrdhlqqgsanfiyddflqgtmai