PDB entry 1k92

View 1k92 on RCSB PDB site
Description: Crystal Structure of Uncomplexed E. coli Argininosuccinate Synthetase
Class: ligase
Keywords: n-type ATP pyrophosphatase, ligase
Deposited on 2001-10-26, released 2001-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.163
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argininosuccinate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ARGG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k92a1, d1k92a2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k92A (A:)
    ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
    eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
    gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
    dykmsvekaystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrf
    eqghpvalngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallh
    iayerlltgihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevt
    lelrrgndysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfg
    yaktgllsssaasgvpqvenlenkgqsvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k92A (A:)
    ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
    eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
    gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
    dykmsvekaystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrf
    eqghpvalngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallh
    iayerlltgihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevt
    lelrrgndysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfg
    yaktgllsssaasgvpqvenlenk