PDB entry 1k91

View 1k91 on RCSB PDB site
Description: Solution Structure of Calreticulin P-domain subdomain (residues 221-256)
Class: metal transport
Keywords: hairpin, metal transport
Deposited on 2001-10-26, released 2002-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calreticulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18418 (1-36)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1k91a1, d1k91a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k91A (A:)
    gkpehipdpdakkpedwdeemdgeweppviqnpeykg