PDB entry 1k8w

View 1k8w on RCSB PDB site
Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA
Class: lyase/RNA
Keywords: protein-RNA complex, T stem-loop, tRNA, LYASE/RNA COMPLEX
Deposited on 2001-10-25, released 2001-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1k8wa3, d1k8wa5, d1k8wa6
  • Chain 'B':
    Compound: 5'-r(*gp*gp*cp*ap*ap*cp*gp*gp*up*(fhu)p*cp*gp*ap*up*cp*cp*cp*gp*up*up*gp*c)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8wA (A:)
    mghhhhhhhhhhssghiegrhmdingvllldkpqgmssndalqkvkriynanraghtgal
    dplatgmlpiclgeatkfsqylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeq
    laaaldtfrgdieqipsmysalkyqgkklyeyarqgievprearpitvyellfirhegne
    leleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtlehlrelveqae
    qqdipaaelldpllmpmdspasdypvvnlpltssvyfkngnpvrtsgapleglvrvtege
    ngkfigmgeiddegrvaprrlvveypa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8wA (A:)
    mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
    lldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysa
    lkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlg
    eklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspa
    sdypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrl
    vvey
    

  • Chain 'B':
    No sequence available.