PDB entry 1k8w

View 1k8w on RCSB PDB site
Description: Crystal structure of the E. coli pseudouridine synthase TruB bound to a T stem-loop RNA
Deposited on 2001-10-25, released 2001-12-31
The last revision prior to the SCOP 1.67 freeze date was dated 2001-12-31, with a file datestamp of 2001-12-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.184
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8wA (A:)
    mghhhhhhhhhhssghiegrhmdingvllldkpqgmssndalqkvkriynanraghtgal
    dplatgmlpiclgeatkfsqylldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeq
    laaaldtfrgdieqipsmysalkyqgkklyeyarqgievprearpitvyellfirhegne
    leleihcskgtyirtiiddlgeklgcgahviylrrlavskypvermvtlehlrelveqae
    qqdipaaelldpllmpmdspasdypvvnlpltssvyfkngnpvrtsgapleglvrvtege
    ngkfigmgeiddegrvaprrlvveypa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8wA (A:)
    mdingvllldkpqgmssndalqkvkriynanraghtgaldplatgmlpiclgeatkfsqy
    lldsdkryrviarlgqrtdtsdadgqiveerpvtfsaeqlaaaldtfrgdieqipsmysa
    lkyqgkklyeyarqgievprearpitvyellfirhegneleleihcskgtyirtiiddlg
    eklgcgahviylrrlavskypvermvtlehlrelveqaeqqdipaaelldpllmpmdspa
    sdypvvnlpltssvyfkngnpvrtsgapleglvrvtegengkfigmgeiddegrvaprrl
    vvey