PDB entry 1k8v

View 1k8v on RCSB PDB site
Description: The NMR-derived Conformation of Neuropeptide F from Moniezia expansa
Class: unknown function
Keywords: neuropeptide F, Moniezia expansa, NPF, UNKNOWN FUNCTION
Deposited on 2001-10-25, released 2002-06-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuropeptide f
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k8va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k8vA (A:)
    pdkdfivnpsdlvldnkaalrdylrqineyfaiigrprf