PDB entry 1k8v

View 1k8v on RCSB PDB site
Description: the nmr-derived conformation of neuropeptide f from moniezia expansa
Deposited on 2001-10-25, released 2002-06-12
The last revision prior to the SCOP 1.69 freeze date was dated 2002-06-12, with a file datestamp of 2002-06-12.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1k8va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k8vA (A:)
    pdkdfivnpsdlvldnkaalrdylrqineyfaiigrprf