PDB entry 1k8u

View 1k8u on RCSB PDB site
Description: crystal structure of calcium-free (or apo) human s100a6; cys3met mutant (selenomethionine derivative)
Class: signaling protein
Keywords: s100a6, calcyclin, calcium regulatory protein, calcium free, apo, cacy, signaling protein
Deposited on 2001-10-25, released 2002-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.186
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s100a6
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06703 (Start-89)
    • modified residue (2)
    • modified residue (56)
  Domains in SCOPe 2.08: d1k8ua_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1k8uA (A:)
  mampldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedl
  drnkdqevnfqeyvtflgalaliynealkg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1k8uA (A:)
  ampldqaigllvaifhkysgregdkhtlskkelkeliqkeltigsklqdaeiarlmedld
  rnkdqevnfqeyvtflgalaliynealkg