PDB entry 1k8h

View 1k8h on RCSB PDB site
Description: NMR Structure of Small Protein B (SmpB) from Aquifex aeolicus
Class: RNA binding protein
Keywords: SmpB, SsrA associated protein
Deposited on 2001-10-24, released 2002-03-20
The last revision prior to the SCOP 1.73 freeze date was dated 2002-04-10, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small Protein B
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1k8ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k8hA (A:)
    gksdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeaw
    lynlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkv
    lialakgkklydr