PDB entry 1k8g

View 1k8g on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA
Class: DNA binding protein/DNA
Keywords: Protein-DNA Complex, telomeres, sequence specific ssDNA binding protein, OB folds, structure, protein single strand DNA interactions, 3'-DNA end binding protein, telomere end binding protein, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2001-10-24, released 2001-12-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k8ga1, d1k8ga2
  • Chain 'B':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k8gb1, d1k8gb2
  • Chain 'C':
    Compound: Telomere-binding protein alpha subunit
    Species: Sterkiella nova [TaxId:200597]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1k8gc1, d1k8gc2
  • Chain 'D':
    Compound: 5'-d(tp*tp*gp*gp*gp*g)-3'
  • Chain 'E':
    Compound: 5'-d(tp*tp*gp*gp*gp*g)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8gA (A:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gA (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktyicslkivdptlylkqsdyatlvlyakr
    fedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdav
    sdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdv
    vakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkk
    vlilshysniitfiqssklakelrakiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k8gB (B:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gB (B:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqsdyatlv
    lyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqein
    nqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqaqk
    gdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatydet
    stqkkvlilshysniitfiqssklakelrakiqdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k8gC (C:)
    mstaakqnrstsrvskkktaapkegaakksdkghkyeyvelakasltsaqpqhfyavvid
    atfpyktnqeryicslkivdptlylkqqkgagdasdyatlvlyakrfedlpiihragdii
    rvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdavsdttpfsfsskhat
    iekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdvvakilqvheldeyt
    nelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkkvlilshysniitfi
    qssklakelrakiqddhsve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gC (C:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgasdya
    tlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtq
    einnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaq
    aqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsaty
    detstqkkvlilshysniitfiqssklakelrakiqdd
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.