PDB entry 1k8g

View 1k8g on RCSB PDB site
Description: Crystal Structure of the N-terminal domain of Oxytricha nova telomere end binding protein alpha subunit both uncomplexed and complexed with telomeric ssDNA
Deposited on 2001-10-24, released 2001-12-20
The last revision prior to the SCOP 1.59 freeze date was dated 2001-12-20, with a file datestamp of 2001-12-20.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k8gA (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gA (A:)
    yeyvelakasltsaqpqhfyavvidatfpyktyicslkivdptlylkqsdyatlvlyakr
    fedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqeinnqdav
    sdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqaqkgdfdv
    vakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatydetstqkk
    vlilshysniitfiqssklakelrakiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1k8gB (B:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gB (B:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqsdyatlv
    lyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtqein
    nqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaqaqk
    gdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsatydet
    stqkkvlilshysniitfiqssklakelrakiqdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1k8gC (C:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgagdas
    dyatlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrs
    vtqeinnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytaln
    kaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirs
    atydetstqkkvlilshysniitfiqssklakelrakiqdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k8gC (C:)
    yeyvelakasltsaqpqhfyavvidatfpyktnqeryicslkivdptlylkqqkgasdya
    tlvlyakrfedlpiihragdiirvhratlrlyngqrqfnanvfyssswalfstdkrsvtq
    einnqdavsdttpfsfsskhatiekneisilqnlrkwanqyfssysvissdmytalnkaq
    aqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfphvrtgevvrirsaty
    detstqkkvlilshysniitfiqssklakelrakiqdd