PDB entry 1k87

View 1k87 on RCSB PDB site
Description: Crystal structure of E.coli PutA (residues 1-669)
Deposited on 2001-10-23, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1k87A (A:)
    pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
    mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
    naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgetia
    ealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgi
    siklsalhprysraqydrvmeelyprlksltllarqydiginidaeeadrleisldllek
    lcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraq
    mdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypg
    qyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsf
    vnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1k87A (A:)
    pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
    mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnrspslfvnaatwg
    llftgneaslsrslnriigksgeplirkgvdmamrlmgeqfvtgetiaealanarkleek
    gfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiyegpgisiklsalhprys
    raqydrvmeelyprlksltllarqydiginidaeeadrleisldlleklcfepelagwng
    igfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdseikraqmdglegypvytr
    kvytdvsylacakkllavpnliypqfathnahtlaaiyqlagqnyypgqyefqclhgmge
    plyeqvtgkvadgklnrpcriyapvgthetllaylvrrllengantsfvnriadtslpld
    elvadpvtaveklaqqegqtglphpkiplprdly